PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006419m
Common NameEUTSA_v10006419mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27357 Da    PI: 7.4227
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006419mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+ rqvtfskR+ g+lKKA+ELSvLCd+eva+iifss+gklye+s+
  Thhalv10006419m  9 KRIENKISRQVTFSKRKSGLLKKAYELSVLCDVEVALIIFSSSGKLYEFSN 59
                     79***********************************************95 PP

2K-box84.91.6e-2879169797
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      ++  e+ ++sl+qe+a+Lk+++e+L r++R llGe+L++Ls++eLq Le+qLe +l+ iR++K+++++e++eel++ke++l + n++L+ +
  Thhalv10006419m  79 NNRLEESTQSLCQEVANLKSKYESLLRTHRYLLGENLGELSVQELQTLERQLEGALSAIRKRKTHVITEEMEELRRKERQLGDMNEKLKLE 169
                      44456669*******************************************************************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.38161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-31276IPR002100Transcription factor, MADS-box
CDDcd002651.05E-39278No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003198.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-2584169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.64786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGRVEVKR IENKISRQVT FSKRKSGLLK KAYELSVLCD VEVALIIFSS SGKLYEFSNA  60
GIDKTFERYY RCKNNILDNN RLEESTQSLC QEVANLKSKY ESLLRTHRYL LGENLGELSV  120
QELQTLERQL EGALSAIRKR KTHVITEEME ELRRKERQLG DMNEKLKLET EGQGFQGFQD  180
LLLSSATAAG PSAFSSHHNS MDCDVGHFLQ IGFQQQYEKG DGSLVIKSNL GCDCETNFVQ  240
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-21269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138142KRKTH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00417DAPTransfer from AT3G61120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402519.11e-176hypothetical protein EUTSA_v10006419mg
SwissprotQ388371e-117AGL13_ARATH; Agamous-like MADS-box protein AGL13
TrEMBLV4LND31e-176V4LND3_EUTSA; Uncharacterized protein
STRINGBra014454.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43022654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61120.11e-119AGAMOUS-like 13